6. Compare the following sequences taken from four different proteins, and select the answer that best characterizes their relationships. 1 PDWLKDNDYLLHGHRPPMPFFRACFKSIFRIHTETGNIWTHLLGFVLFLF 2 PDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLF 3 PDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLF 4 PEYMKDNEYILN-YYRADWSIRDAFFSVFSFHNESLNVWTHLIGFIFFVA (A) Protein 3 reveals the greatest evolutionary divergence. (B) Comparing proteins 1 and 2 reveals that these two proteins have diverged the most throughout evolution. (C) Protein 4 is the protein that shows the greatest overall homology to protein 1. (D) Proteins 1 and 4 show a greater evolutionary distance than proteins 1 and 2. (E) The portions of amino acid sequence shown suggest that these proteins are completely unrelated.